SubscribeElectronic signatures, a missed Virgin Atlantic flight, and two mystery guests
October 18, 2006
I’m always looking for ways to streamline my business, and one of my favorite tricks is electronic signatures, which save me and my clients an unbelievable amount of time, effort, paper, and ink. Plus, they’re really, really cool!
Many of my clients travel frequently, and e-signatures mean they can sign anywhere they have Internet access — at the office, at a conference, in an airport, or at a Starbucks/T-mobile hotspot. A few weeks ago, we were expecting a counter-offer to come in while my client was going to be en-route from San Francisco to London on a Virgin Atlantic flight. No worries…that Virgin flight had wifi access! Unfortunately, my client missed the flight, so I’m not yet able to say that clients have signed while flying.
The two mystery guests? You’ll find them in my presentation on this topic, best viewed in full Powerpoint presentation mode.
The platform I use is Docusign, a Seattle-based company. Before getting into the specifics, a quick disclaimer, then a digression into what electronic signatures are and are not.
Disclaimer: I’m not a lawyer, and there are a lot of legal issues around electronic signatures of which you should be careful. Don’t take my word for either their efficacy or their legality in real estate transactions in California — do your own research. If you live outside California, I have no idea what laws might apply to you.
Digression: A “signature” is simply an action a person performs to show consent to something. Examples of signatures include:
- Writing your name on paper in a stylized and consistent manner. Because this is currently the most widely-used signature method, it has become known as — you guessed it! — a “signature.”
- Pressing your fingerprint
- Marking an “X”
An “electronic signature”, then, is simply an electronic action a person performs to show consent to something. Examples of electronic signatures include:
- Clicking “place your order” on Amazon.com.
- Clicking “pay” on your online bank’s web site.
- Clicking “sign” on a Docusign document
Using Docusign e-signatures in California real estate transactions
Docusign uses a familiar motif — yellow “sticky” sign here labels — to make the process easy and understandable. You start with any document in electronic form, such as an online real estate purchase contract from your forms provider. If the original is in paper format, then you need to either scan it or e-fax it to yourself.
Once you have the document in electronic form, you simply “print” it to Docusign to get it ready. You specify the email addresses of the signers…
… then drag yellow “stickies” to where your clients need to sign…
…and then email it to them. When they open the email, they’ll be directed to sign in to Docusign, they’ll see the document, and then sign by simply clicking where it says “Sign here.”
When they’re done clicking in all the places that need a signature or initial, they email it back to you, and then you can open it, print it, forward it etc. The signature is a stylized cursive version of their name along with a unique identification number:
That’s all there is to it!
Trust me, after getting over the initial learning curve, you and your clients will simply not believe how you survived without electronic signatures.
Comments
9 Responses to “Electronic signatures, a missed Virgin Atlantic flight, and two mystery guests”
Got something to say?
this product doesn’t work very well. I had issues with users being able to sign, clunking and confusing they said. I moved to suredocs.com and it works alot better.
[...] To me, this looked like a classic test case for using electronic signatures, which would have transformed this 2 hour (at least) ordeal into a fairly easy 30 minute process, not to mention looking incredibly cool. [...]
[...] Electronic signatures, a missed Virgin Atlantic flight, and two Reflections on the real estate market, technology, and the confluence of the two Three Oceans Real Estate Reflections on the real estate market, technology, and the confluence of [...]
[...] me, this looked like a classic test case for using electronic signatures, which would have transformed this 2 hour (at least) ordeal into a fairly easy 30 minute process, [...]
map_all_freegorahe.com4.txt;15;20
[...] September, real estate broker and blogger Kevin Boer discussed how he’s saved his clients time, effort, paper and ink by using DocuSign. Even [...]
[...] of the audio clip I like best starts at about the 12:30 mark in the full audio track. 3. A how-to discussion from RE Blogger Kevin Boer who we have spoken with a few times a. What is interesting here is [...]
http://mbvmswnernrtierptyhkrtkwernnyhtg.com mbvmswnernrtierptyhkrtkwernnyhtg
mbvmswnernrtierptyhkrtkwernnyhtg
mbvmswnernrtierptyhkrtkwernnyhtg
Тех кто не был в Чехии, но кому приходится по душе средневековая эпоха, мы приглашаем посетить удивительное место – ресторан Прага. Здесь вас ждут роскошные блюда, как современные, так и средневековые явства. Приходите – не пожалеете! Мы ждём Вас на нашем сайте – Заходите!